ID	DDInter735
	Drug Type	biotech
	Protein Chemical Formula	C845H1339N223O243S9
	Protein Average Weight	18800.000
	CAS Number	121181-53-1
	Description	Filgrastim is a short-acting recombinant, non-pegylated human granulocyte colony-stimulating factor (G-CSF) analog produced by recombinant DNA technology. It has an amino acid sequence identical to endogenous G-CSF, but it is non-glycosylated unlike the endogenous G-CSF and has an N-terminal methionine added in the sequence for expression in _E. Coli_.[L40714] Human G-CSF is a glycoprotein that regulates the production and release of neutrophils from the bone marrow. Filgrastim mimics the biological actions of G-CSF to increase the levels of neutrophils in the blood.[L40719] It has a number of therapeutic uses, including the management and prevention of infections and febrile neutropenia in patients receiving myelosuppressive chemotherapy or radiation therapy. It is also used to manage severe chronic neutropenia and mobilize hematopoietic progenitor cells to the peripheral blood for collection by leukapheresis in patients undergoing peripheral blood progenitor cell collection and therapy.[L40714] Filgrastim was approved in the US in 1991 and there are biosimilars available with similar therapeutic indications.[A245858] Tbo-filgrastim was approved by the FDA on August 29, 2012.[L36325] Filgrastim-sndz was approved on March 6, 2015 [L40768] and filgrastim-ayow was approved on March 2, 2022.[L40773] A long-acting, pegylated G-CSF, [pegfilgrastim], was made available to increase the duration of action of the drug.
	ATC Classification	L03AA02
Sequences	>Protein sequence MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWA PLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQ QMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Useful Links	DrugBank PubChem Substance KEGG Drug PharmGKB UniProtKB Therapeutic Targets Database Wikipedia ChEMBL