Drugs Information:
Exenatide
Basic Information
|
||
| ID | DDInter706 | |
| Drug Type | biotech | |
| Protein Chemical Formula | C184H282N50O60S | |
| Protein Average Weight | 4186.600 | |
| CAS Number | 141758-74-9 | |
| Description | Exenatide is a glucagon-like peptide-1 (GLP-1) analog[L42690]. It activates the GLP-1 receptor and increases insulin secretion, decreases glucagon secretion, and slows gastric emptying to improve glycemic control[L42690]. Exenatide was given FDA approval on April 28, 2005[L6106]. It is available as immediate- and extended-release formulations.[L42685,L42690] Bydureon, the brand name product of extended-release exenatide in an injectable suspension, was discontinued in 2021. Bydureon BCise, an auto-injector extended-release formulation, remains available.[L42700] | |
| ATC Classification | A10BJ01 | |
| Sequences | >Exenatide HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | |
| Useful Links | DrugBank PubChem Substance KEGG Drug PharmGKB Therapeutic Targets Database Wikipedia ChEMBL | |
Interactions with
Exenatide
Filter:
| Severity level | ID | Name | Mechanism | Detail |
|---|
Interactions with diseases
Filter:
| Severity level | Disease name | Text | References |
|---|
Interactions with foods
Filter:
| Severity level | Food name | Description | Management | Mechanism | References |
|---|
Interactions with compound preparation
| Multi-DRUG trade | Multi-DRUG | Drug type | Warning | Note |
|---|