Basic Information
ID DDInter643
Drug Type biotech
Protein Chemical Formula C204H301N51O64
Protein Average Weight 4491.876
CAS Number 159519-65-0
Description Enfuvirtide is a 36 amino acid biomimetic peptide that is structurally similar to the HIV proteins that are responsible for the fusion of the virus to cell membranes and subsequent intracellular uptake. The first agent in the novel class of antiretroviral drugs called HIV fusion inhibitors, enfuvirtide works by inhibiting HIV-1 fusion with CD4 cells.
ATC Classification J05AX07
Sequences >DB00109 sequence YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Useful Links DrugBank PubChem Substance ChemSpider BindingDB PharmGKB UniProtKB Therapeutic Targets Database Wikipedia ChEMBL
Interactions with Enfuvirtide
Filter:
Severity level ID Name Mechanism Detail
Interactions with diseases
Filter:
Severity level Disease name Text References
Interactions with foods
Filter:
Severity level Food name Description Management Mechanism References
Interactions with compound preparation
Multi-DRUG trade Multi-DRUG Drug type Warning Note