Basic Information
ID DDInter445
Drug Type biotech
Protein Chemical Formula C207H308N56O58S
Protein Average Weight 4541.066
CAS Number 12427-33-7
Description Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.
ATC Classification H01AA01
Sequences >ACTH(1-39) SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
Useful Links DrugBank PubChem Substance KEGG Compound KEGG Drug PharmGKB Wikipedia ChEMBL
Interactions with Corticotropin
Filter:
Severity level ID Name Mechanism Detail
Interactions with diseases
Filter:
Severity level Disease name Text References
Interactions with foods
Filter:
Severity level Food name Description Management Mechanism References
Interactions with compound preparation
Multi-DRUG trade Multi-DRUG Drug type Warning Note