ID	DDInter27
	Drug Type	biotech
	Protein Chemical Formula	C6428H9912N1694O1987S46
	Protein Average Weight	144190.300
	CAS Number	331731-18-1
	Description	Adalimumab is a subcutaneously administered biological disease modifier for the treatment of rheumatoid arthritis and other chronic debilitating diseases mediated by tumor necrosis factor.[A39984,A39999] It was originally launched by Abbvie in the U.S. and approved in 2002 by the FDA.[A39983] This drug is frequently known as _Humira_. It is produced by recombinant DNA technology using a mammalian cell expression system. This drug is available in a prefilled syringe form and convenient pen form for subcutaneous self-administered doses.[A39983] A new biosimilar to adalimumab, named _adalimumab-adaz_, was approved by the FDA on October 31, 2018. This biosimilar is known as _Hyrimoz_, and is a trademark of Novartis AG.[L4799] Other biosimilars of adalimumab include adalimumab-fkjp, which was approved in July 2022,[L42495] and HADLIMA (adalimumab-bwwd), which was approved in August 2022.[L42935]
	ATC Classification	L04AB04
Sequences	> Adalimumab Light chain: DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Useful Links	DrugBank PubChem Substance KEGG Drug PharmGKB UniProtKB Therapeutic Targets Database Wikipedia ChEMBL