ID	DDInter2032
	Drug Type	biotech
	Protein Chemical Formula	None
	Protein Average Weight	54000.000
	CAS Number	1821402-21-4
	Description	Myasthenia gravis (MG) is an autoimmune disorder characterized by significant muscle weakness - particularly in the eye, throat, and extremities - caused by autoantibodies attacking the neuromuscular junction.[A243759] The production of IgG autoantibodies against acetylcholine receptors (AChRs) is one of the more common pathophysiological mechanisms behind MG, and results in the destruction of these receptors and a reduction in electrical nerve impulses.[A243759,A243784] Efgartigimod alfa is a first-in-class[L39501] antagonist of the neonatal Fc receptor (FcRn) used in the treatment of myasthenia gravis (MG).[L39496] IgG antibodies, including the autoantibodies responsible for MG symptoms, can be 'recycled', a process which significantly extends their half-life, by evading lysosomal degradation via binding with FcRn.[L39509] By antagonizing this interaction, efgartimod alfa prevents this recycling phase and thus decreases the half-life of IgG, effectively lowering circulating levels of IgG autoantibodies against AChRs. Efgartimod alfa was granted FDA approval on December 17, 2021 [L39501] and European Commission approval on August 11, 2022.[L43190]
	ATC Classification	-
Sequences	>SUBUNIT_1 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALKFHYTQKSLSLSPGK
Useful Links	DrugBank Wikipedia