ID	DDInter201
	Drug Type	biotech
	Protein Chemical Formula	C6538H10034N1716O2033S44
	Protein Average Weight	149000.000
	CAS Number	216974-75-3
	Description	There is a great deal of evidence indicating that vascular endothelial growth factor (VEGF) is important for the survival and proliferation of cancer cells.[A192939,A192837,A192891,A193275] VEGF plays an important role in angiogenesis, lymphangiogenesis, and tumor growth, which are all factors that contribute to its attractiveness as a therapeutic target for anti-cancer therapies.[A192834,A192888,A192837,A192891,A192894] In 2004, bevacizumab (Avastin) gained FDA approval for specific types of cancer, and became the first antiangiogenic agent introduced to the market.[A193272,A193275] It is a humanized monoclonal IgG antibody, and inhibits angiogenesis by binding and neutralizing VEGF-A.[A192888,A192939] Bevacizumab is generally indicated for use in combination with different chemotherapy regimens which are specific to the type, severity, and stage of cancer.[L12648] Bevacizumab was approved by the European Commission on April 21, 2021.[L43130] There are also biosimilars of bevacizumab available, such as bevacizumab-awwb, bevacizumab-maly, and bevacizumab-adcd. Interestingly, researchers have identified higher VEGF expression in patients with COVID-19, which may contribute to lung pathologies including acute respiratory syndrome (ARDS) and acute lung injury (ALI).[L12699] As such, bevacizumab is being investigated for the treatment of lung complications associated with severe cases of COVID-19.[L12699]
	ATC Classification	L01FG01 S01LA08
Sequences	>"Bevacizumab light chain" DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Useful Links	DrugBank PubChem Substance PharmGKB Therapeutic Targets Database Wikipedia ChEMBL