Drugs Information:
Tesamorelin
Basic Information
|
||
| ID | DDInter1773 | |
| Drug Type | biotech | |
| Protein Chemical Formula | None | |
| Protein Average Weight | - | |
| CAS Number | 218949-48-5 | |
| Description | Tesamorelin is a stabilized synthetic peptide analogue of the hypothalamic peptide, Growth Hormone Releasing Hormone (GHRH) indicated for the reduction of excess abdominal fat in HIV-infected patients with lipodystrophy. Lipodystrophy is a metabolic condition characterized by insulin resistance, fat redistribution, and hyperlipidemia associated with antiretroviral therapy for HIV infection. | |
| ATC Classification | H01AC06 | |
| Sequences | >results for sequence "Egrifta Sequence" starting "TyrAlaAspAla" YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL | |
| Useful Links | DrugBank ChEBI PubChem Substance KEGG Drug ChemSpider UniProtKB Wikipedia ChEMBL | |
Interactions with
Tesamorelin
Filter:
| Severity level | ID | Name | Mechanism | Detail |
|---|
Interactions with diseases
Filter:
| Severity level | Disease name | Text | References |
|---|
Interactions with foods
Filter:
| Severity level | Food name | Description | Management | Mechanism | References |
|---|
Interactions with compound preparation
| Multi-DRUG trade | Multi-DRUG | Drug type | Warning | Note |
|---|