Drugs Information:
Teduglutide
Basic Information
|
||
| ID | DDInter1753 | |
| Drug Type | biotech | |
| Protein Chemical Formula | C164H252N44O55S | |
| Protein Average Weight | 3752.000 | |
| CAS Number | 197922-42-2 | |
| Description | Teduglutide is a glucagon-like peptide-2 (GLP-2) analogue. It is made up of 33 amino acids and is manufactured using a strain of Escherichia coli modified by recombinant DNA technology. Teduglutide differs from GLP-2 by one amino acid (alanine is substituted by glycine). The significance of this substitution is that teduglutide is longer acting than endogenous GLP-2 as it is more resistant to proteolysis from dipeptidyl peptidase-4. FDA approved on December 21, 2012. | |
| ATC Classification | A16AX08 | |
| Sequences | >Protein sequence for teduglutide HGDGSFSDEMNTILDNLAARDFINWLIQTKITD | |
| Useful Links | DrugBank ChEBI PubChem Substance KEGG Compound KEGG Drug Wikipedia ChEMBL | |
Interactions with
Teduglutide
Filter:
| Severity level | ID | Name | Mechanism | Detail |
|---|
Interactions with diseases
Filter:
| Severity level | Disease name | Text | References |
|---|
Interactions with foods
Filter:
| Severity level | Food name | Description | Management | Mechanism | References |
|---|
Interactions with compound preparation
| Multi-DRUG trade | Multi-DRUG | Drug type | Warning | Note |
|---|