Drugs Information:
Sermorelin
Basic Information
|
||
| ID | DDInter1661 | |
| Drug Type | biotech | |
| Protein Chemical Formula | C149H246N44O42S | |
| Protein Average Weight | 3357.882 | |
| CAS Number | 86168-78-7 | |
| Description | Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues | |
| ATC Classification | V04CD03 H01AC04 | |
| Sequences | >DB00010 sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQ | |
| Useful Links | DrugBank PubChem Substance KEGG Compound PharmGKB Therapeutic Targets Database Wikipedia | |
Interactions with
Sermorelin
Filter:
| Severity level | ID | Name | Mechanism | Detail |
|---|
Interactions with diseases
Filter:
| Severity level | Disease name | Text | References |
|---|
Interactions with foods
Filter:
| Severity level | Food name | Description | Management | Mechanism | References |
|---|
Interactions with compound preparation
| Multi-DRUG trade | Multi-DRUG | Drug type | Warning | Note |
|---|