Basic Information
ID DDInter1410
Drug Type biotech
Protein Chemical Formula C1549H2430N408O448S8
Protein Average Weight 34192.853
CAS Number 885051-90-1
Description Pegloticase is a porcine recombinant PEGylated uricase indicated for the treatment of chronic gout in adult patients that do not respond to other types of therapies.[L42425] Pegloticase has a similar activity to rasburicase, an enzyme that metabolizes uric acid to allantoin. In gout patients treated with pegloticase, the conversion of uric acid to allantoin leads to lower plasma uric acid concentrations.[L42425] Pegloticase has a longer terminal elimination half-life thanks to the addition of a polyethylene glycol (PEG) group. Therefore therapeutic drug levels can be maintained with infrequent and relatively low pegloticase doses.[A249980] The PEG group also gives pegloticase a lower potential to induce an immune response.[A249980] However, cases of anaphylaxis and infusion reactions have been reported in patients treated with this drug.[L42425] Pegloticase was approved by the FDA in 2014, and in 2022, the drug label included the co-administration of pegloticase and methotrexate.[L42425]
ATC Classification M04AX02
Sequences > Pegloticase TYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATTVQLTLSSKKDYLHGDNSDVI PTDTIKNTVNVLAKFKGIKSIETFAVTICEHFLSSFKHVIRAQVYVEEVPWKRFEKNGVK HVHAFIYTPTGTHFCEVEQIRNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKD RCFATQVYCKWRYHQGRDVDFEATWDTVRSIVLQKFAGPYDKGEYSPSVQKTLYDIQVLT LGQVPEIEDMEISLPNIHYLNIDMSKMGLINKEEVLLPLDNPYGKITGTVKRKLSSRL
Useful Links DrugBank PubChem Substance KEGG Drug Wikipedia ChEMBL
Interactions with Pegloticase
Filter:
Severity level ID Name Mechanism Detail
Interactions with diseases
Filter:
Severity level Disease name Text References
Interactions with foods
Filter:
Severity level Food name Description Management Mechanism References
Interactions with compound preparation
Multi-DRUG trade Multi-DRUG Drug type Warning Note