Basic Information
ID DDInter1131
Drug Type biotech
Protein Chemical Formula C331H518N94O101S7
Protein Average Weight 7649.000
CAS Number 68562-41-4
Description Mecasermin contains recombinant-DNA-engineered human insulin-like growth factor-1 (rhIGF-1)[FDA Label]. IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1.
ATC Classification H01AC03
Sequences >Mecasermin GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPAKSA
Useful Links DrugBank PubChem Substance KEGG Drug PharmGKB Therapeutic Targets Database Wikipedia ChEMBL
Interactions with Mecasermin
Filter:
Severity level ID Name Mechanism Detail
Interactions with diseases
Filter:
Severity level Disease name Text References
Interactions with foods
Filter:
Severity level Food name Description Management Mechanism References
Interactions with compound preparation
Multi-DRUG trade Multi-DRUG Drug type Warning Note