Drugs Information:
Liraglutide
Basic Information
|
||
| ID | DDInter1077 | |
| Drug Type | biotech | |
| Protein Chemical Formula | C172H265N43O51 | |
| Protein Average Weight | 3751.200 | |
| CAS Number | 204656-20-2 | |
| Description | Victoza contains liraglutide, a synthetic analog of human glucagon-like peptide-1(GLP-1) and acts as a GLP-1 receptor agonist.[Label,A6932] Liraglutide is 97% similar to native human GLP-1, differing primarily by substituting arginine for lysine at position 34.[A6932] Liraglutide is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor.[A6932] Liraglutide was granted FDA approval on January 25, 2010.[L6070] | |
| ATC Classification | A10AE56 A10BJ02 | |
| Sequences | >Liraglutide Sequence (gamma-E-palmitoyl at E21) HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG | |
| Useful Links | DrugBank ChEBI PubChem Substance KEGG Drug PharmGKB UniProtKB Wikipedia ChEMBL | |
Interactions with
Liraglutide
Filter:
| Severity level | ID | Name | Mechanism | Detail |
|---|
Interactions with diseases
Filter:
| Severity level | Disease name | Text | References |
|---|
Interactions with foods
Filter:
| Severity level | Food name | Description | Management | Mechanism | References |
|---|
Interactions with compound preparation
| Multi-DRUG trade | Multi-DRUG | Drug type | Warning | Note |
|---|